PDB entry 6apt

View 6apt on RCSB PDB site
Description: Trypanosoma brucei hypoxanthine guanine phosphoribosyltransferase in complex with {[(2S)-3-(2-amino-6-oxo-1,6-dihydro-9H-purin-9-yl)propane-1,2-diyl]bis(oxyethane-2,1-diyl)}bis(phosphonic acid)
Class: transferase
Keywords: Trypanosoma brucei, Purine salvage, acyclic nucleoside biphosphonate, TRANSFERASE
Deposited on 2017-08-17, released 2018-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6apta_
  • Chain 'B':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6aptb_
  • Heterogens: 45T, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aptA (A:)
    hhhhhhmepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlk
    gsfvftadmvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvled
    ildtaltlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldy
    dqsyrevrdvvilkpsvyetwgkelerrkaageakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aptA (A:)
    ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
    rilgdfgvptrveflrdirgkhvlvledildtaltlrevvdslkksepasiktlvaidkp
    ggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aptB (B:)
    hhhhhhmepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlk
    gsfvftadmvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvled
    ildtaltlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldy
    dqsyrevrdvvilkpsvyetwgkelerrkaageakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aptB (B:)
    ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
    rilgdfgvptrveflrirgkhvlvledildtaltlrevvdslkksepasiktlvaidkpg
    grkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgk