PDB entry 6aps

View 6aps on RCSB PDB site
Description: Trypanosoma brucei hypoxanthine guanine phosphoribosyltransferase in complex with [(2-((Guanine-9H-yl)methyl)propane-1,3 diyl)bis(oxy)]bis(methylene))diphosphonic acid
Class: transferase
Keywords: Trypanosoma brucei, Purine salvage, acyclic nucleoside biphosphonate, TRANSFERASE
Deposited on 2017-08-17, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07010 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.07: d6apsa1, d6apsa2
  • Chain 'B':
    Compound: hypoxanthine-guanine phosphoribosyltransferase
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Gene: HGPRT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6apsb_
  • Heterogens: SV2, MG, PEG, TRS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6apsA (A:)
    hhhhhhmepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlk
    gsfvftadmvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvled
    ildtaltlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldy
    dqsyrevrdvvilkpsvyetwgkelerrkaageakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6apsA (A:)
    hhhmepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsf
    vftadmvrilgdfgvptrveflrlcdirgkhvlvledildtaltlrevvdslkksepasi
    ktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgk
    elerr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6apsB (B:)
    hhhhhhmepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlk
    gsfvftadmvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvled
    ildtaltlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldy
    dqsyrevrdvvilkpsvyetwgkelerrkaageakr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6apsB (B:)
    ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
    rilgdfgvptrveflrdirgkhvlvledildtaltlrevvdslkksepasiktlvaidkp
    ggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgkelerrkaa