PDB entry 6apb

View 6apb on RCSB PDB site
Description: Crystal Structure of Non-Neutralizing Infant Antibody ADI-14359 in Complex with Postfusion RSV F Glycoprotein
Class: immune system
Keywords: viral fusion glycoprotein, immunoglobulin, respiratory syncytial virus, IMMUNE SYSTEM
Deposited on 2017-08-17, released 2018-03-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fusion glycoprotein F0,Fusion glycoprotein F0
    Species: Human respiratory syncytial virus [TaxId:11250]
    Gene: F, MZ07_64039gpF, MZ07_64040gpF
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Fusion glycoprotein F0,Fusion glycoprotein F0
    Species: Human respiratory syncytial virus [TaxId:11250]
    Gene: F, MZ07_64039gpF, MZ07_64040gpF
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Fusion glycoprotein F0,Fusion glycoprotein F0
    Species: Human respiratory syncytial virus [TaxId:11250]
    Gene: F, MZ07_64039gpF, MZ07_64040gpF
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: IgG H chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6APB (0-End)
    Domains in SCOPe 2.08: d6apbh_
  • Chain 'L':
    Compound: ADI-14359 Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6APB (0-End)
    Domains in SCOPe 2.08: d6apbl1, d6apbl2
  • Heterogens: NAG

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6apbH (H:)
    qvtlresgpalvkptqtltltctfsgfslstsgmcvswirqppgkalewlaridwdddky
    ystslktrltiskdtsknqvvltmtnmdpvdtatyycaratnydssgyyslyfdywgqgt
    lvtvssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfp
    avlqssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6apbH (H:)
    qvtlresgpalvkptqtltltctfsgfslstsgmcvswirqppgkalewlaridwdddky
    ystslktrltiskdtsknqvvltmtnmdpvdtatyycaratnydssgyyslyfdywgqgt
    lvtvssastkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
    glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6apbL (L:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpytfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6apbL (L:)
    diqmtqspsslsasvgdrvtitcrasqsissylnwyqqkpgkapklliyaasslqsgvps
    rfsgsgsgtdftltisslqpedfatyycqqsystpytfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrg