PDB entry 6ap7

View 6ap7 on RCSB PDB site
Description: Crystal Structure of DAD2 in complex with 2-(2-methyl-3-nitroanilino)benzoic acid
Class: plant protein
Keywords: alpha/beta hydrolase, PLANT PROTEIN
Deposited on 2017-08-17, released 2018-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable strigolactone esterase DAD2
    Species: PETUNIA HYBRIDA [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • Uniprot J9U5U9
      • engineered mutation (90)
    Domains in SCOPe 2.07: d6ap7a_
  • Chain 'B':
    Compound: Probable strigolactone esterase DAD2
    Species: PETUNIA HYBRIDA [TaxId:4102]
    Gene: dad2
    Database cross-references and differences (RAF-indexed):
    • Uniprot J9U5U9
      • engineered mutation (90)
    Domains in SCOPe 2.07: d6ap7b_
  • Heterogens: BNY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ap7A (A:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidqcayvghsvsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap7A (A:)
    qtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdf
    fdfrryttldpyvddllhildalgidqcayvghsvsamigilasirrpelfskliligas
    prflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmr
    pditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwln
    ieghlphlsaptllaqelrralsh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ap7B (B:)
    ggmgqtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsv
    npdffdfrryttldpyvddllhildalgidqcayvghsvsamigilasirrpelfsklil
    igasprflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtl
    fnmrpditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntv
    hwlnieghlphlsaptllaqelrralshr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ap7B (B:)
    qtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdf
    fdfrryttldpyvddllhildalgidqcayvghsvsamigilasirrpelfskliligas
    prflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmr
    pditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwln
    ieghlphlsaptllaqelrralsh