PDB entry 6aos

View 6aos on RCSB PDB site
Description: Crystal structure of the A/Brisbane/10/2007 (H3N2) influenza virus hemagglutinin L194P mutant in complex with 3'-SLNLN
Class: viral protein
Keywords: Influenza A virus, hemagglutinin, mutant, receptor binding, antigenicity, VIRAL PROTEIN
Deposited on 2017-08-16, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemagglutinin HA1 chain
    Species: Influenza A virus (A/Brisbane/10/2007(H3N2)) [TaxId:476294]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8W891 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d6aosa1, d6aosa2
  • Chain 'B':
    Compound: Hemagglutinin HA2chain
    Species: Influenza A virus (A/Brisbane/10/2007(H3N2)) [TaxId:476294]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aosb_
  • Heterogens: NAG, BMA, MAN, SIA, GAL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aosA (A:)
    anpgatlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctl
    idallgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfn
    wtgvtqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpg
    tdndqifpyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillin
    stgnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacp
    ryvkqntlklatgmrnvpekqtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aosA (A:)
    pgatlclghhavpngtivktitndqievtnatelvqssstgeicdsphqildgenctlid
    allgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnwt
    gvtqngtssacirrsnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgtd
    ndqifpyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillinst
    gnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpry
    vkqntlklatgmrnvpe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aosB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegigqaadlkstqaaidqingklnrligktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqik
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aosB (B:)
    gifgaiagfiengwegmvdgwygfrhqnsegigqaadlkstqaaidqingklnrligktn
    ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
    ktkkqlrenaedmgngcfkiyhkcdnacigsirngtydhdvyrdealnnrfqi