PDB entry 6aod

View 6aod on RCSB PDB site
Description: FXIa antibody complex
Class: blood clotting/immune system
Keywords: FXIa Antibody FAB, BLOOD CLOTTING, BLOOD CLOTTING-IMMUNE SYSTEM complex
Deposited on 2017-08-15, released 2018-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FXIa Antibody FAB Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AOD (Start-213)
    Domains in SCOPe 2.07: d6aoda1, d6aoda2
  • Chain 'B':
    Compound: FXIa Antibody FAB Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AOD (0-End)
  • Chain 'C':
    Compound: Coagulation factor XI
    Species: Homo sapiens [TaxId:9606]
    Gene: F11
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03951 (0-End)
      • engineered mutation (62)
      • engineered mutation (103)
      • engineered mutation (112)
      • engineered mutation (187)
    Domains in SCOPe 2.07: d6aodc_
  • Heterogens: SO4, GOL, CO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aodA (A:)
    divmtkspsslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslqsgvps
    rfsgsgsgteftltisslqpedfatyyclqhdiyastfgpgtkvdikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aodA (A:)
    psslsasvgdrvtitcrasqgirndlgwyqqkpgkapkrliyaasslqsgvpsrfsgsgs
    gteftltisslqpedfatyyclqhdiyastfgpgtkvdikrtvaapsvfifppsdeqlks
    gtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadye
    khkvyacevthqglsspvtksfnrgec
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6aodC (C:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilqqseikedtsffgvqeiiihdqykmaesgydiallklettvqytdsqrpislpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdaggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqahhh
    hhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aodC (C:)
    ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
    ilqqseikedtsffgvqeiiihdqykmaesgydiallklettvqytdsqrpislpskgdr
    nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
    kdackgdaggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektq