PDB entry 6ank

View 6ank on RCSB PDB site
Description: Synaptotagmin-7, C2A- and C2B-domains
Class: protein binding
Keywords: calcium/phospholipid binding protein, protein binding
Deposited on 2017-08-13, released 2017-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin-7
    Species: Rattus norvegicus [TaxId:10116]
    Gene: SYT7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6anka1, d6anka2
  • Chain 'B':
    Compound: Synaptotagmin-7
    Species: Rattus norvegicus [TaxId:10116]
    Gene: SYT7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ankb1, d6ankb2
  • Heterogens: EDO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ankA (A:)
    gspgisgggggildsmgrlenlgriqfsvgynfqestltvkvmkaqelpakdfsgtsdpf
    vkiyllpdkkhkletkvkrknlnphwnetflfegfpyekvvqrilylqvldydrfsrndp
    igevsiplnkvdltqmqtfwkdlkpcsdgsgsrgelllslcynpsansiivniikarnlk
    amdiggtsdpyvkvwlmykdkrvekkktvtkkrnlnpifnesfafdipteklrettiiit
    vmdkdklsrndvigkiylswksgpgevkhwkdmiarprqpvaqwhqlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ankA (A:)
    nlgriqfsvgynfqestltvkvmkaqelpakdfsgtsdpfvkiyllpdkkhkletkvkrk
    nlnphwnetflfegfpyekvvqrilylqvldydrfsrndpigevsiplnkvdltqmqtfw
    kdlkpsrgelllslcynpsansiivniikarnlkamdiggtsdpyvkvwlmykdkrvekk
    ktvtkkrnlnpifnesfafdipteklrettiiitvmdkdklsrndvigkiylswksgpge
    vkhwkdmiarprqpvaqwhqlk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ankB (B:)
    gspgisgggggildsmgrlenlgriqfsvgynfqestltvkvmkaqelpakdfsgtsdpf
    vkiyllpdkkhkletkvkrknlnphwnetflfegfpyekvvqrilylqvldydrfsrndp
    igevsiplnkvdltqmqtfwkdlkpcsdgsgsrgelllslcynpsansiivniikarnlk
    amdiggtsdpyvkvwlmykdkrvekkktvtkkrnlnpifnesfafdipteklrettiiit
    vmdkdklsrndvigkiylswksgpgevkhwkdmiarprqpvaqwhqlka
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ankB (B:)
    nlgriqfsvgynfqestltvkvmkaqelpakdfsgtsdpfvkiyllpdkkhkletkvkrk
    nlnphwnetflfegfpyekvvqrilylqvldydrfsrndpigevsiplnkvdltqmqtfw
    kdlkpsrgelllslcynpsansiivniikarnlkamdiggtsdpyvkvwlmykdkrvekk
    ktvtkkrnlnpifnesfafdipteklrettiiitvmdkdklsrndvigkiylswksgpge
    vkhwkdmiarprqpvaqwhqlka