PDB entry 6anj

View 6anj on RCSB PDB site
Description: Synaptotagmin-7, C2A domain
Class: protein binding
Keywords: calcium/phospholipid binding protein, protein binding
Deposited on 2017-08-13, released 2017-09-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Synaptotagmin-7
    Species: Rattus norvegicus [TaxId:10116]
    Gene: SYT7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q62747 (19-147)
      • expression tag (10-18)
    Domains in SCOPe 2.07: d6anja1, d6anja2
  • Heterogens: CA, TBU, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6anjA (A:)
    gspgisgggggildsmgrlenlgriqfsvgynfqestltvkvmkaqelpakdfsgtsdpf
    vkiyllpdkkhkletkvkrknlnphwnetflfegfpyekvvqrilylqvldydrfsrndp
    igevsiplnkvdltqmqtfwkdlkpcsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6anjA (A:)
    gildsmgrlenlgriqfsvgynfqestltvkvmkaqelpakdfsgtsdpfvkiyllpdkk
    hkletkvkrknlnphwnetflfegfpyekvvqrilylqvldydrfsrndpigevsiplnk
    vdltqmqtfwkdlkpcsd