PDB entry 6ane

View 6ane on RCSB PDB site
Description: Crystal Structure of Ideonella sakaiensis PET Hydrolase
Class: hydrolase
Keywords: PETase, AB hydrolase, cutinase, plastic, HYDROLASE
Deposited on 2017-08-12, released 2018-04-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-25, with a file datestamp of 2018-04-20.
Experiment type: XRAY
Resolution: 2.02 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(ethylene terephthalate) hydrolase
    Species: Ideonella sakaiensis (strain 201-F6) [TaxId:1547922]
    Gene: ISF6_4831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6anea_
  • Chain 'B':
    Compound: Poly(ethylene terephthalate) hydrolase
    Species: Ideonella sakaiensis (strain 201-F6) [TaxId:1547922]
    Gene: ISF6_4831
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0K8P6T7 (Start-263)
      • expression tag (264-265)
    Domains in SCOPe 2.08: d6aneb1, d6aneb2
  • Chain 'C':
    Compound: Poly(ethylene terephthalate) hydrolase
    Species: Ideonella sakaiensis (strain 201-F6) [TaxId:1547922]
    Gene: ISF6_4831
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6anec_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aneA (A:)
    mqtnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpg
    ytarqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiy
    gkvdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacend
    siapvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndt
    rystfacenpnstrvsdfrtancslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aneA (A:)
    tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
    arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
    vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
    apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
    stfacenpnstrvsdfrtancs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aneB (B:)
    mqtnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpg
    ytarqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiy
    gkvdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacend
    siapvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndt
    rystfacenpnstrvsdfrtancslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aneB (B:)
    tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
    arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
    vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
    apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
    stfacenpnstrvsdfrtancsle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6aneC (C:)
    mqtnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpg
    ytarqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiy
    gkvdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacend
    siapvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndt
    rystfacenpnstrvsdfrtancslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aneC (C:)
    tnpyargpnptaasleasagpftvrsftvsrpsgygagtvyyptnaggtvgaiaivpgyt
    arqssikwwgprlashgfvvitidtnstldqpssrssqqmaalrqvaslngtssspiygk
    vdtarmgvmgwsmggggslisaannpslkaaapqapwdsstnfssvtvptlifacendsi
    apvnssalpiydsmsrnakqfleinggshscansgnsnqaligkkgvawmkrfmdndtry
    stfacenpnstrvsdfrtanc