PDB entry 6an6

View 6an6 on RCSB PDB site
Description: Crystal structure of Escherichia coli HPPK in complex with bisubstrate analogue inhibitor HP-72
Class: transferase/inhibitor
Keywords: alpha beta, TRANSFERASE-INHIBITOR complex
Deposited on 2017-08-12, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: folK, b0142, JW0138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6an6a_
  • Chain 'B':
    Compound: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: folK, b0142, JW0138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6an6b_
  • Heterogens: J1I, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6an6A (A:)
    tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
    etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
    rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6an6B (B:)
    tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
    etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
    rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw