PDB entry 6an4

View 6an4 on RCSB PDB site
Description: Crystal structure of Escherichia coli HPPK in complex with bisubstrate analogue inhibitor HP-39 (J1F)
Class: transferase/inhibitor
Keywords: alpha beta, TRANSFERASE-INHIBITOR complex
Deposited on 2017-08-12, released 2018-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 1.47 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: folK, b0142, JW0138
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6an4a_
  • Heterogens: J1F, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >6an4A (A:)
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvrkaerwgprtldldimlfgnevinterltvphydmkn
rgfmlwplfeiapelvfpdgemlrqilhtrafdklnkw

    Sequence, based on observed residues (ATOM records): (download) 
    >6an4A (A:)
tvayiaigsnlaspleqvnaalkalgdipeshiltvssfyrtpplgpqdqpdylnaaval
etslapeellnhtqrielqqgrvprtldldimlfgnevinterltvphydmknrgfmlwp
lfeiapelvfpdgemlrqilhtrafdklnkw