PDB entry 6an1

View 6an1 on RCSB PDB site
Description: Crystal structure of the complex between PPARgamma LBD and the ligand AM-879
Class: nuclear protein
Keywords: Nuclear receptor, ligand binding domain, NUCLEAR PROTEIN
Deposited on 2017-08-11, released 2018-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-02-14, with a file datestamp of 2018-02-09.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6an1a_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6an1b_
  • Heterogens: BKY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6an1A (A:)
    gshmeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviyd
    mnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldl
    ndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefa
    vkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessql
    fakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6an1A (A:)
    lnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkik
    kevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslm
    nkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviils
    gdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllq
    vikktetdmslhpllqeiykd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6an1B (B:)
    gshmeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviyd
    mnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldl
    ndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefa
    vkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessql
    fakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >6an1B (B:)
    sadlralakhlydsyiksfpltkakarailtgkdkspfviydmnslmmgedkikfkhike
    vairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnk
    dgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgd
    rpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvi
    kktehpllqeiyk