PDB entry 6amp

View 6amp on RCSB PDB site
Description: Crystal structure of H172A PHM (CuH absent, CuM present)
Class: oxidoreductase
Keywords: peptidylglycine monooxygenase, peptidylglycine 2-hydroxylase, phm, oxidoreductase
Deposited on 2017-08-10, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2.48 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-glycine alpha-amidating monooxygenase
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PAM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14925
      • engineered mutation (127)
    Domains in SCOPe 2.07: d6ampa1, d6ampa2
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ampA (A:)
    neclgtigpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmd
    tvhhmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgs
    kyfvlqvaygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnad
    iscqykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvt
    fgdilaarcvftgegrteathiggtssdemcnlyimyymeakyalsfmtctknvapdmfr
    tipaeanipipv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ampA (A:)
    ecligpvtpldasdfaldirmpgvtpkesdtyfcmsmrlpvdeeafvidfkprasmdtvh
    hmllfgcnmpsstgsywfcdegtctdkanilyawarnapptrlpkgvgfrvggetgskyf
    vlqvaygdisafrdnhkdcsgvsvhltrvpqpliagmylmmsvdtvippgekvvnadisc
    qykmypmhvfayrvhthhlgkvvsgyrvrngqwtligrqnpqlpqafypvehpvdvtfgd
    ilaarcvftgegrteathisdemcnlyimyymeakyalsfmtctknvapdmfrtipaean
    ipip