PDB entry 6am3

View 6am3 on RCSB PDB site
Description: Regulator of G protein signaling (RGS) 17 in complex with Ca2+
Class: signaling protein
Keywords: G protein, regulator, signaling, SIGNALING PROTEIN
Deposited on 2017-08-09, released 2019-02-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-13, with a file datestamp of 2019-02-08.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 17
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS17, RGSZ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6am3a_
  • Chain 'X':
    Compound: Regulator of G-protein signaling 17
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS17, RGSZ2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6am3x_
  • Heterogens: CA, PG4, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6am3A (A:)
    smnptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqnkkvi
    eekarmiyedyisilspkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrdsfpr
    flnsqiyksfvestags
    

    Sequence, based on observed residues (ATOM records): (download)
    >6am3A (A:)
    nptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqnkkviee
    karmiyedyisilspkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrdsfprfl
    nsqiyksfvest
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >6am3X (X:)
    smnptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqnkkvi
    eekarmiyedyisilspkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrdsfpr
    flnsqiyksfvestags
    

    Sequence, based on observed residues (ATOM records): (download)
    >6am3X (X:)
    nptaeevlswsqnfdkmmkapagrnlfreflrteyseenllfwlacedlkkeqnkkviee
    karmiyedyisilspkevsldsrvrevinrnlldpnphmyedaqlqiytlmhrdsfprfl
    nsqiyksfvestags