PDB entry 6alw

View 6alw on RCSB PDB site
Description: The crystal structure of the Staphylococcus aureus Fatty acid Kinase (Fak) B1 protein loaded with 12-Methyl Myristic Acid (C15:0) to 1.63 Angstrom resolution
Class: transferase
Keywords: Staphylococcus aureus, FakB1, 12-Methyl Myristic Acid, 12-Methyltetradecanoic acid, C15:0, TRANSFERASE
Deposited on 2017-08-08, released 2018-11-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: EDD domain protein, DegV family
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: AYM28_04055, AYM37_04055, ERS072738_00223, ERS072840_01626, ERS074020_00218, HMPREF3211_01094
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6alwa_
  • Chain 'B':
    Compound: EDD domain protein, DegV family
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: AYM28_04055, AYM37_04055, ERS072738_00223, ERS072840_01626, ERS074020_00218, HMPREF3211_01094
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6alwb_
  • Heterogens: BNV, BMJ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6alwA (A:)
    mkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkmassqtip
    ttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvhafdskl
    aamiegcyvlraiemveegyepqqiiddltnmrehtgaylivddlknlqksgritgaqaw
    vgtllkmkpvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvingdhfed
    gqalykklqddcpsayqvaysefgpvvaahlgsgglglgyvgrkirlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6alwB (B:)
    mkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkmassqtip
    ttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvhafdskl
    aamiegcyvlraiemveegyepqqiiddltnmrehtgaylivddlknlqksgritgaqaw
    vgtllkmkpvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvingdhfed
    gqalykklqddcpsayqvaysefgpvvaahlgsgglglgyvgrkirlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6alwB (B:)
    mkiavmtdstsylsqdlidkyniqiaplsvtfddgknftesneiaieefynkmassqtip
    ttsqpaigewitkyemlrdqgytdiiviclssgisgsyqssyqagemvegvnvhafdskl
    aamiegcyvlraiemveegyepqqiiddltnmrehtgaylivddlknlqksgritgllkm
    kpvlkfedgkiipeekvrtkkraiqtlekkvldivkdfeevtlfvingdhfedgqalykk
    lqddcpsayqvaysefgpvvaahlgsgglglgyvgrkirlt