PDB entry 6alk

View 6alk on RCSB PDB site
Description: NMR solution structure of the major beech pollen allergen Fag s 1
Class: allergen
Keywords: allergen, ligand binding, conformational diversity
Deposited on 2017-08-08, released 2018-08-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-08, with a file datestamp of 2020-01-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fag s 1 pollen allergen
    Species: Fagus sylvatica [TaxId:28930]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6alka_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6alkA (A:)
    gvftyesetttvitparlfkafvldadnlipkvapqaiksseiiegsggpgtikkitfge
    gsqfnyvkhrideidnanftyactliegdaisetlekiayeiklvaspdggsilkstsky
    htkgdheikedqikagkeeasgifkaveayllanpaayh