PDB entry 6akr

View 6akr on RCSB PDB site
Description: Crystal structure of the PDE4D catalytic domain in complex with osthole
Class: hydrolase
Keywords: phosphodiesterase 4d, HYDROLASE
Deposited on 2018-09-03, released 2020-02-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6akrb_
  • Chain 'C':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D
    Database cross-references and differences (RAF-indexed):
  • Heterogens: A0O, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6akrB (B:)
    gshmiprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllkt
    fkipvdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaai
    fasaihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltk
    kqrqslrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmv
    hcadlsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfid
    yivhplwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqf
    eltl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6akrB (B:)
    fgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdt
    litylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihd
    vdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslr
    kmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsn
    ptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplw
    etwadlvhpdaqdildtlednrewyqsti
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.