PDB entry 6ako

View 6ako on RCSB PDB site
Description: Crystal Structure of FOXC2 DBD Bound to DBE2 DNA
Class: DNA binding protein/DNA
Keywords: FOXC; DNA binding domain; DNA recognition; Crystal Structure; Lymphoedema distichiasis syndrome, DNA BINDING PROTEIN-DNA complex
Deposited on 2018-09-03, released 2019-02-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-06, with a file datestamp of 2019-02-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA (5'-d(cp*ap*ap*ap*ap*tp*gp*tp*ap*ap*ap*cp*ap*ap*gp*a)-3')
    Species: Homo sapiens [TaxId:9606]
  • Chain 'B':
    Compound: DNA (5'-d(tp*cp*tp*tp*gp*tp*tp*tp*ap*cp*ap*tp*tp*tp*tp*g)-3')
    Species: Homo sapiens [TaxId:9606]
  • Chain 'C':
    Compound: Forkhead box protein C2
    Species: Homo sapiens [TaxId:9606]
    Gene: FOXC2, FKHL14, MFH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99958 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6akoc1, d6akoc2
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6akoC (C:)
    gpkppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnec
    fvkvprddkkpgkgsywtldpdsynmfengsflrrrrrfkkkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6akoC (C:)
    gpkppysyialitmaiqnapekkitlngiyqfimdrfpfyrenkqgwqnsirhnlslnec
    fvkvprddkkpgkgsywtldpdsynmfengsflrrrr