PDB entry 6aj8

View 6aj8 on RCSB PDB site
Description: Crystal structure of Trypanosoma brucei glycosomal isocitrate dehydrogenase in complex with NADP+, alpha-ketoglutarate and ca2+
Class: oxidoreductase
Keywords: Trypanosoma brucei, glycosome, metabolism, isocitrate dehydrogenase, OXIDOREDUCTASE
Deposited on 2018-08-27, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Isocitrate dehydrogenase [NADP]
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q387G0 (0-412)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d6aj8a_
  • Chain 'B':
    Compound: Isocitrate dehydrogenase [NADP]
    Species: Trypanosoma brucei brucei [TaxId:5702]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q387G0 (0-412)
      • engineered mutation (0)
    Domains in SCOPe 2.07: d6aj8b_
  • Heterogens: NAP, CA, AKG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6aj8A (A:)
    snkisatgvlveldgdemtrviwkkiketlifpfvnvpieyydlsmenrdktedrvtvea
    ayaikkhgvgvkcatitpdearvkefnlkkmwrspngtirtilggtvfrepiicsnvprl
    vttwkkpvvigrhafgdqysatdavvkepgtfemrfipanggepkvykvfdyksggvmmg
    myntddsirdfarscfefalarkwplylstkntilkhydgrfkdifaemykalyetkfkt
    cgifyehrliddmvahcmrseggyvwacknydgdvqsdslaqgfgslgmmtsilmtpdgk
    tveveaahgtvtrhyrdyqkgketstnpvasifawtralahrarvdnnntlleftqrled
    viiatieagamtedlaicikgeknvvradylntdefidavsqrlkvamqkskv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6aj8B (B:)
    snkisatgvlveldgdemtrviwkkiketlifpfvnvpieyydlsmenrdktedrvtvea
    ayaikkhgvgvkcatitpdearvkefnlkkmwrspngtirtilggtvfrepiicsnvprl
    vttwkkpvvigrhafgdqysatdavvkepgtfemrfipanggepkvykvfdyksggvmmg
    myntddsirdfarscfefalarkwplylstkntilkhydgrfkdifaemykalyetkfkt
    cgifyehrliddmvahcmrseggyvwacknydgdvqsdslaqgfgslgmmtsilmtpdgk
    tveveaahgtvtrhyrdyqkgketstnpvasifawtralahrarvdnnntlleftqrled
    viiatieagamtedlaicikgeknvvradylntdefidavsqrlkvamqkskv