PDB entry 6ais

View 6ais on RCSB PDB site
Description: Loop deletion mutant (deleting two residues)
Class: de novo protein
Keywords: Outer surface protein A, OspA, LIPID BINDING PROTEIN, DE NOVO PROTEIN
Deposited on 2018-08-24, released 2019-07-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-03, with a file datestamp of 2019-06-28.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'O':
    Compound: Outer surface protein A
    Species: Borrelia burgdorferi [TaxId:139]
    Database cross-references and differences (RAF-indexed):
    • PDB 6AIS (Start-248)
    Domains in SCOPe 2.07: d6aiso_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >6aisO (O:)
    gshmknsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkad
    askvkltisddlgqttlevfksdgstlvskkvtskdkssteekfnekgevsekiitradg
    trleytgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsveln
    dtdsstkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitk
    ldeiknalk
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aisO (O:)
    nsvsvdlpgsmkvlvskssnadgkydliatvdalelsgtsdknngsgvlegvkadaskvk
    ltisddlgqttlevfksdgstlvskkvtskdkssteekfnekgevsekiitradgtrley
    tgiksdgsgkakevlkgyvlegtltaekttlvvkegtvtlsknisksgavsvelndtdss
    tkktaawnsgtstltitvnskktkdlvftssntitvqqydsngtslegsaveitkldeik
    nalk