PDB entry 6aiq

View 6aiq on RCSB PDB site
Description: High resolution structure of recombinant high-potential iron-sulfur protein
Class: metal binding protein
Keywords: iron-sulfur protein, metal-binding protein, metal binding protein
Deposited on 2018-08-24, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 0.85 Å
R-factor: N/A
AEROSPACI score: 0.99 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high-potential iron-sulfur protein
    Species: Thermochromatium tepidum [TaxId:1050]
    Gene: hip
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aiqa_
  • Heterogens: SF4, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6aiqA (A:)
    aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
    cqlfpgklinvngwcaswtlkag