PDB entry 6aid

View 6aid on RCSB PDB site
Description: Structural insights into the unique polylactate degrading mechanism of Thermobifida alba cutinase
Class: hydrolase
Keywords: hydrolase
Deposited on 2018-08-22, released 2019-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-02-27, with a file datestamp of 2019-02-22.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: esterase
    Species: Thermobifida alba [TaxId:53522]
    Gene: est2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aida_
  • Heterogens: CA, 9YL, NA, LAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aidA (A:)
    mrgshhhhhhgsapaqaanpyergpnptesmlearsgpfsvseerasrfgadgfgggtiy
    yprenntygaiaispgytgtqssiawlgeriashgfvviaidtnttldqpdsrarqlnaa
    ldymltdassavrnridasrlavmghsmggggtlrlasqrpdlkaaipltpwhlnkswrd
    itvptliigaeydtiasvtlhskpfynsipsptdkayleldgashfapnitnktigmysv
    awlkrfvdedtrytqflcpgprtgllsdveeyrstcpf
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aidA (A:)
    anpyergpnptesmlearsgpfsvseerasrfgadgfgggtiyyprenntygaiaispgy
    tgtqssiawlgeriashgfvviaidtnttldqpdsrarqlnaaldymltdassavrnrid
    asrlavmghsmggggtlrlasqrpdlkaaipltpwhlnkswrditvptliigaeydtias
    vtlhskpfynsipsptdkayleldgashfapnitnktigmysvawlkrfvdedtrytqfl
    cpgprtgllsdveeyrstcpf