PDB entry 6ai7

View 6ai7 on RCSB PDB site
Description: Mandelate oxidase mutant-Y128F with the C4a-OH-FMN adduct
Class: flavoprotein
Keywords: FMN-dependent oxidase, FLAVOPROTEIN
Deposited on 2018-08-21, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-hydroxymandelate oxidase
    Species: Amycolatopsis orientalis [TaxId:31958]
    Gene: hmo
    Database cross-references and differences (RAF-indexed):
    • Uniprot O52792 (Start-359)
      • engineered mutation (130)
    Domains in SCOPe 2.07: d6ai7a_
  • Heterogens: 9Q6, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ai7A (A:)
    gshmtyvsladleraardvlpgeifdflaggsgteaslvanrtalervfviprmlrdltd
    vtteidifgrraalpmavapvayqrlfhpegelavaraardagvpytictlssvsleeia
    avggrpwfqlfwlrdekrsldlvrraedagceaivftvdvpwmgrrlrdmrngfalpewv
    taanfdagtaahrrtqgvsavadhtarefapatwesveavrahtdlpvvlkgilavedar
    ravdagaggivvsnhggrqldgavpgiemlgeivaavsggcevlvdggirsggdvlkata
    lgasavlvgrpvmwalaaagqdgvrqllellaeevrdamglagcesvgaarrlntklgvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ai7A (A:)
    adleraardvlpgeifdflaggsgteaslvanrtalervfviprmlrdltdvtteidifg
    rraalpmavapvayqrlfhpegelavaraardagvpytictlssvsleeiaavggrpwfq
    lfwlrdekrsldlvrraedagceaivftvdvpwmgrrlrdmrngfalpewvtaanfdfap
    atwesveavrahtdlpvvlkgilavedarravdagaggivvsnhggrqldgavpgiemlg
    eivaavsggcevlvdggirsggdvlkatalgasavlvgrpvmwalaaagqdgvrqllell
    aeevrdamglagcesvgaarrlntklgvv