PDB entry 6ai5

View 6ai5 on RCSB PDB site
Description: Disulfide-free, Zn-directed tetramer of the engineered cyt cb562 variant, C96T/A104AB3
Class: electron transport
Keywords: de novo protein, ELECTRON TRANSPORT
Deposited on 2018-08-21, released 2019-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-09-11, with a file datestamp of 2019-09-06.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (88)
      • engineered mutation (97)
      • engineered mutation (99-100)
      • engineered mutation (103)
    Domains in SCOPe 2.07: d6ai5a_
  • Chain 'C':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (88)
      • engineered mutation (97)
      • engineered mutation (99-100)
      • engineered mutation (103)
    Domains in SCOPe 2.07: d6ai5c_
  • Chain 'E':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (88)
      • engineered mutation (97)
      • engineered mutation (99-100)
      • engineered mutation (103)
    Domains in SCOPe 2.07: d6ai5e_
  • Chain 'G':
    Compound: Soluble cytochrome b562
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0ABE7 (0-105)
      • engineered mutation (33)
      • engineered mutation (37)
      • engineered mutation (40-41)
      • engineered mutation (58)
      • engineered mutation (65)
      • engineered mutation (68)
      • engineered mutation (72)
      • engineered mutation (76)
      • engineered mutation (88)
      • engineered mutation (97)
      • engineered mutation (99-100)
      • engineered mutation (103)
    Domains in SCOPe 2.07: d6ai5g_
  • Heterogens: HEM, ZN, CL, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ai5A (A:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqhaaeqlkttcnhchqayr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ai5C (C:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqhaaeqlkttcnhchqayr
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ai5E (E:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqhaaeqlkttcnhchqayr
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ai5G (G:)
    adlednmetlndnlkviekadnaaqvkdaltkmaaaaadawsatppkledkspdspemhd
    frhgfwiligqihdalhlanegkvkeaqhaaeqlkttcnhchqayr