PDB entry 6ahs

View 6ahs on RCSB PDB site
Description: Mouse Kallikrein 7 in complex with imidazolinylindole derivative
Class: hydrolase
Keywords: protease, HYDROLASE
Deposited on 2018-08-20, released 2019-01-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-02, with a file datestamp of 2018-12-28.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kallikrein-7
    Species: Mus musculus [TaxId:10090]
    Gene: KLK7, PRSS6, SCCE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ahsa_
  • Heterogens: 9YO, TRS, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6ahsA (A:)
    iidgykckegshpwqvallkgnqlhcggvlvdkywvltaahckmgqyqvqlgsdkigdqs
    aqkikatksfrhpgystkthvndimlvrldepvkmsskveavqlpehceppgtsctvsgw
    gtttspdvtfpsdlmcsdvklissreckkvykdllgktmlcagipdsktntcngdsggpl
    vcndtlqglvswgtypcgqpndpgvytqvckykrwvmetmkthr