PDB entry 6ahe

View 6ahe on RCSB PDB site
Description: Crystal structure of enoyl-ACP reductase from Acinetobacter baumannii in complex with NAD and AFN-1252
Class: oxidoreductase
Keywords: Fabi, Acinetobacter baumannii, NAD, AFN-1252, Inhibitor complex, OXIDOREDUCTASE
Deposited on 2018-08-17, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.29 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841 [TaxId:575584]
    Gene: NC_009085.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ahea_
  • Chain 'B':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841 [TaxId:575584]
    Gene: NC_009085.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aheb_
  • Chain 'C':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841 [TaxId:575584]
    Gene: NC_009085.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ahec_
  • Chain 'D':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841 [TaxId:575584]
    Gene: NC_009085.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ahed_
  • Heterogens: NAD, 0WE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aheA (A:)
    mtqgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsk
    lvfpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahd
    isaysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylassl
    gvdgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwa
    sgitgeilyvdagfntvgmsqsmmdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aheA (A:)
    qgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsklv
    fpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahdis
    aysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylasslgv
    dgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwasg
    itgeilyvdagfntvgmsqs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aheB (B:)
    mtqgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsk
    lvfpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahd
    isaysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylassl
    gvdgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwa
    sgitgeilyvdagfntvgmsqsmmdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aheB (B:)
    qgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsklv
    fpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahdis
    aysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylasslgv
    dgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwasg
    itgeilyvdagfntvgmsqs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6aheC (C:)
    mtqgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsk
    lvfpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahd
    isaysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylassl
    gvdgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwa
    sgitgeilyvdagfntvgmsqsmmdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aheC (C:)
    qgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsklv
    fpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahdis
    aysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylasslgv
    dgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwasg
    itgeilyvdagfntvgmsqs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6aheD (D:)
    mtqgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsk
    lvfpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahd
    isaysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylassl
    gvdgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwa
    sgitgeilyvdagfntvgmsqsmmdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aheD (D:)
    qgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsklv
    fpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahdis
    aysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylasslgv
    dgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwasg
    itgeilyvdagfntvgmsqs