PDB entry 6ah9

View 6ah9 on RCSB PDB site
Description: Crystal structure of enoyl-ACP reductase from Acinetobacter baumannii in complex with NAD and Triclosan
Class: oxidoreductase
Keywords: Fabi, Acinetobacter baumannii, NAD, Triclosan, Inhibitor complex, OXIDOREDUCTASE
Deposited on 2018-08-17, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Enoyl-[acyl-carrier-protein] reductase [NADH]
    Species: Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841 [TaxId:575584]
    Gene: NC_009085.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ah9a_
  • Heterogens: NAD, TCL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ah9A (A:)
    mtqgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsk
    lvfpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahd
    isaysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylassl
    gvdgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwa
    sgitgeilyvdagfntvgmsqsmmdde
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ah9A (A:)
    qgllagkrfliagvasklsiaygiaqalhregaelaftypneklkkrvdefaeqfgsklv
    fpcdvavdaeidnafaelakhwdgvdgvvhsigfapahtldgdftdvtdrdgfkiahdis
    aysfvamaraakpllqarqgclltltyqgservmpnynvmgmakasleagvrylasslgv
    dgirvnaisagpirtlaasgiksfrkmldanekvaplkrnvtieevgnaalflcspwasg
    itgeilyvdagfntvgmsqs