PDB entry 6agy

View 6agy on RCSB PDB site
Description: Aspergillus fumigatus Af293 NDK
Class: transferase
Keywords: Kinase, Transferase
Deposited on 2018-08-15, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoside diphosphate kinase
    Species: Aspergillus fumigatus Af293 [TaxId:330879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6agya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6agyA (A:)
    msneqtfiaikpdgvqrgligpiisrfenrgfklvamklvsppqsqleqhyadlsdkpff
    kglvsymlsgpicamvwegrdvvktgrtilgatnplasapgtirgdfaidvgrnvchgsd
    svenakkeialwfkpeeliswksatfdwvyekalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agyA (A:)
    sneqtfiaikpdgvqrgligpiisrfenrgfklvamklvsppqsqleqhyadlsdkpffk
    glvsymlsgpicamvwegrdvvktgrtilgatnplasapgtirgdfaidvgrnvchgsds
    venakkeialwfkpeeliswksatfdwvy