PDB entry 6agx

View 6agx on RCSB PDB site
Description: The cocrystal structure of FGFR2 bound with compound 14 harboring 5H-pyrrolo[2,3-b]pyrazine scaffold
Class: transferase/inhibitor
Keywords: Tyrosine-protein kinase, TRANSFERASE-INHIBITOR complex
Deposited on 2018-08-15, released 2019-08-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-21, with a file datestamp of 2019-08-16.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802 (0-297)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d6agxa_
  • Chain 'B':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802 (0-297)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d6agxb_
  • Chain 'C':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802 (0-297)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d6agxc_
  • Chain 'D':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21802 (0-297)
      • engineered mutation (161)
    Domains in SCOPe 2.07: d6agxd_
  • Heterogens: 9WX

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6agxA (A:)
    elpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatek
    dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmey
    sydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdltarnvlvtennvmkiadfg
    lardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypg
    ipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agxA (A:)
    elpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatek
    dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrpinrvp
    eeqmtfkdlvsctyqlargmeylasqkcihrdltarnvlvtennvmkiadfglardiykk
    ttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkeg
    hrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6agxB (B:)
    elpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatek
    dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmey
    sydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdltarnvlvtennvmkiadfg
    lardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypg
    ipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6agxC (C:)
    elpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatek
    dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmey
    sydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdltarnvlvtennvmkiadfg
    lardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypg
    ipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >6agxC (C:)
    elpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatek
    dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrpnrvpe
    eqmtfkdlvsctyqlargmeylasqkcihrdltarnvlvtennvmkiadfglardiykkt
    tngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypgipveelfkllkegh
    rmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6agxD (D:)
    elpedpkwefprdkltlgkplgegcfgqvvmaeavgidkdkpkeavtvavkmlkddatek
    dlsdlvsememmkmigkhkniinllgactqdgplyviveyaskgnlreylrarrppgmey
    sydinrvpeeqmtfkdlvsctyqlargmeylasqkcihrdltarnvlvtennvmkiadfg
    lardinnidyykkttngrlpvkwmapealfdrvythqsdvwsfgvlmweiftlggspypg
    ipveelfkllkeghrmdkpanctnelymmmrdcwhavpsqrptfkqlvedldriltlt