PDB entry 6agp

View 6agp on RCSB PDB site
Description: Structure of Rac1 in the low-affinity state for Mg2+
Class: signaling protein
Keywords: Nucleotide Binding, Gtpase Activity, GTP Binding, SIGNALING PROTEIN
Deposited on 2018-08-13, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ras-related c3 botulinum toxin substrate 1
    Species: Homo sapiens [TaxId:9606]
    Gene: RAC1, TC25, MIG5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P63000 (0-180)
      • engineered mutation (30)
      • engineered mutation (62)
      • engineered mutation (73)
      • engineered mutation (159)
    Domains in SCOPe 2.07: d6agpa_
  • Heterogens: GDP, MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6agpA (A:)
    mqaikcvvvgdgavgktcllisyttnafpgcyiptvfdnysanvmvdgkpvnlglwdtag
    qecydrlrplsypctdvflicfslvspasfenvrakwypevrhhcpntpiilvgtkldlr
    ddkdtieklkekkltpitypqglamakeigavkylecsactqrglktvfdeairavlcpp
    p