PDB entry 6ag8

View 6ag8 on RCSB PDB site
Description: Crystal structure of Maltose O-acetyltransferase from E. coli
Class: transferase
Keywords: maltose O-acetyltransferase, TRANSFERASE
Deposited on 2018-08-09, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 1.34 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltose o-acetyltransferase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: maa, ylaD, b0459, JW0448
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ag8a_
  • Chain 'C':
    Compound: maltose o-acetyltransferase
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: maa, ylaD, b0459, JW0448
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ag8c_
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ag8A (A:)
    mstekekmiagelyrsadetlsrdrlrarqlihrynhslaeehtlrqqiladlfgqvtea
    yieptfrcdygyniflgnnffanfdcvmldvcpirigdncmlapgvhiytathpidpvar
    nsgaelgkpvtignnvwiggravinpgvtigdnvvvasgavvtkdvpdnvvvggnparii
    kkllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ag8A (A:)
    stekekmiagelyrsadetlsrdrlrarqlihrynhslaeehtlrqqiladlfgqvteay
    ieptfrcdygyniflgnnffanfdcvmldvcpirigdncmlapgvhiytathpidpvarn
    sgaelgkpvtignnvwiggravinpgvtigdnvvvasgavvtkdvpdnvvvggnpariik
    kl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ag8C (C:)
    mstekekmiagelyrsadetlsrdrlrarqlihrynhslaeehtlrqqiladlfgqvtea
    yieptfrcdygyniflgnnffanfdcvmldvcpirigdncmlapgvhiytathpidpvar
    nsgaelgkpvtignnvwiggravinpgvtigdnvvvasgavvtkdvpdnvvvggnparii
    kkllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ag8C (C:)
    stekekmiagelyrsadetlsrdrlrarqlihrynhslaeehtlrqqiladlfgqvteay
    ieptfrcdygyniflgnnffanfdcvmldvcpirigdncmlapgvhiytathpidpvarn
    sgaelgkpvtignnvwiggravinpgvtigdnvvvasgavvtkdvpdnvvvggnpariik
    kl