PDB entry 6ag5

View 6ag5 on RCSB PDB site
Description: Crystal structure of Ard1 N-terminal acetyltransferase E88H/H127E mutant from Sulfolobus solfataricus
Class: transferase
Keywords: Acetyltransferase, TRANSFERASE
Deposited on 2018-08-09, released 2019-08-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-14, with a file datestamp of 2019-08-09.
Experiment type: XRAY
Resolution: 2.32 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N-alpha-acetyltransferase
    Species: Sulfolobus solfataricus P2 [TaxId:273057]
    Gene: AsArd1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q980R9 (Start-166)
      • engineered mutation (87)
      • engineered mutation (126)
    Domains in SCOPe 2.07: d6ag5a_
  • Heterogens: ACO, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ag5A (A:)
    melaekdkgrdftlrnarmddidqiikinrltlpenypyyffvehlkeyglaffvaivdn
    svvgyimpriewgfsnikqlpslvrkgevvsiavleeyrrkgiattlleasmksmkndyn
    aeeiylhvrvsnypaialyeklnfkkvkvlkgyyadgedaylmarplhhhhhhpl
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ag5A (A:)
    dftlrnarmddidqiikinrltlpenypyyffvehlkeyglaffvaivdnsvvgyimpri
    ewgfsnikqlpslvrkgevvsiavleeyrrkgiattlleasmksmkndynaeeiylhvrv
    snypaialyeklnfkkvkvlkgyyadgedaylmarpl