PDB entry 6ag2

View 6ag2 on RCSB PDB site
Description: uPA-HMA
Class: hydrolase
Keywords: Urokinase, Amiloride, HYDROLASE
Deposited on 2018-08-09, released 2019-09-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-09-18, with a file datestamp of 2019-09-13.
Experiment type: XRAY
Resolution: 1.7700000000000002 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'U':
    Compound: urokinase-type plasminogen activator
    Species: Homo sapiens [TaxId:9606]
    Gene: PLAU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00749 (0-End)
      • engineered mutation (120)
      • engineered mutation (143)
    Domains in SCOPe 2.08: d6ag2u_
  • Heterogens: 9X9, SO4, HOH

PDB Chain Sequences:

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >6ag2U (U:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irshtkeenglal
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ag2U (U:)
    iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
    lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
    alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
    mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
    irsht