PDB entry 6afd

View 6afd on RCSB PDB site
Description: DJ-1 with compound 6
Class: hydrolase
Keywords: DJ-1, Parkinson's disease, Drug discovery, Fragment-based drug discovery, HYDROLASE
Deposited on 2018-08-08, released 2018-08-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-10-03, with a file datestamp of 2018-09-28.
Experiment type: XRAY
Resolution: 1.48 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein/nucleic acid deglycase DJ-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARK7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6afda_
  • Heterogens: 72S, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6afdA (A:)
    maskralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasled
    akkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfg
    skvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaq
    vkaplvlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6afdA (A:)
    askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
    kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaicagptallaheigfgs
    kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
    kaplvlk