PDB entry 6afb

View 6afb on RCSB PDB site
Description: DJ-1 C106S incubated with isatin
Class: hydrolase
Keywords: DJ-1, Parkinson's disease, Drug discovery, Fragment-based drug discovery, HYDROLASE
Deposited on 2018-08-08, released 2018-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-29, with a file datestamp of 2018-08-24.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein/nucleic acid deglycase DJ-1
    Species: Homo sapiens [TaxId:9606]
    Gene: PARK7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99497
      • engineered mutation (105)
    Domains in SCOPe 2.07: d6afba_
  • Heterogens: ISN, CL, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6afbA (A:)
    maskralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasled
    akkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaisagptallaheigfg
    skvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaq
    vkaplvlkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >6afbA (A:)
    askralvilakgaeemetvipvdvmrragikvtvaglagkdpvqcsrdvvicpdasleda
    kkegpydvvvlpggnlgaqnlsesaavkeilkeqenrkgliaaisagptallaheigfgs
    kvtthplakdkmmngghytysenrvekdgliltsrgpgtsfefalaivealngkevaaqv
    kaplvlk