PDB entry 6aez

View 6aez on RCSB PDB site
Description: Crystal structure of human CCL5 trimer
Class: cytokine
Keywords: CCL5, RANTES, Chemokine, Oligomer, dimer, CC-type, CYTOKINE
Deposited on 2018-08-07, released 2019-08-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-07, with a file datestamp of 2019-08-02.
Experiment type: XRAY
Resolution: 1.63 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (Start-68)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d6aeza_
  • Chain 'B':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aezb_
  • Chain 'C':
    Compound: c-c motif chemokine 5
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL5, D17S136E, SCYA5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13501 (Start-68)
      • engineered mutation (66)
    Domains in SCOPe 2.07: d6aezc_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aezA (A:)
    mspyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvr
    eyinslsms
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aezA (A:)
    sdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvreyins
    lsms
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aezB (B:)
    mspyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvr
    eyinslems
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aezB (B:)
    pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
    insl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6aezC (C:)
    mspyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvr
    eyinslsms
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aezC (C:)
    pyssdttpccfayiarplprahikeyfytsgkcsnpavvfvtrknrqvcanpekkwvrey
    inslsms