PDB entry 6aec

View 6aec on RCSB PDB site
Description: Binary complex of human DNA Polymerase Mu with MnATP
Class: transferase
Keywords: DNA Polymerase Mu, DNA break repair, Transferase-rNTP complex, TRANSFERASE
Deposited on 2018-08-04, released 2019-05-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-29, with a file datestamp of 2019-05-24.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed DNA/RNA polymerase mu
    Species: Homo sapiens [TaxId:9606]
    Gene: POLM, polmu
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NP87 (Start-270)
      • linker (271)
    • Uniprot Q9NP87 (272-355)
    Domains in SCOPe 2.07: d6aeca1, d6aeca2, d6aeca3
  • Heterogens: ATP, MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aecA (A:)
    gsaaaplspawmpayacqrptplthhntglsealeilaeaagfegsegrlltfcraasvl
    kalpspvttlsqlqglphfgehssrvvqellehgvceevervrrseryqtmklftqifgv
    gvktadrwyreglrtlddlreqpqkltqqqkaglqhhqdlstpvlrsdvdalqqvveeav
    gqalpgatvtltggfrrgklqghdvdflithpkegqeagllprvmcrlqdqglilyhqhq
    hsccesptrlaqqshmdafersfcifrlpqpgswkavrvdlvvapvsqfpfallgwtgsk
    lfqrelrrfsrkekglwlnshglfdpeqktffqaaseedifrhlgleylppeqrna
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aecA (A:)
    wmpayacqrptplthhntglsealeilaeaagfegsegrlltfcraasvlkalpspvttl
    sqlqglphfgehssrvvqellehgvceevervrrseryqtmklftqifgvgvktadrwyr
    eglrtlddlreqpqkltqqqkaglqhhqdlstpvlrsdvdalqqvveeavgqalpgatvt
    ltggfrrgklqghdvdflithpkegqeagllprvmcrlqdqglilyhqhqhafersfcif
    rlpqpgswkavrvdlvvapvsqfpfallgwtgsklfqrelrrfsrkekglwlnshglfdp
    eqktffqaaseedifrhlgleylppeqrna