PDB entry 6ae8

View 6ae8 on RCSB PDB site
Description: Structure insight into histone chaperone Chz1-mediated H2A.Z recognition and replacement
Class: chaperone
Keywords: histone variants, CHAPERONE
Deposited on 2018-08-03, released 2019-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-04-17, with a file datestamp of 2019-04-12.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone H2B.1,Histone H2A.Z
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ae8a1, d6ae8a2
  • Chain 'B':
    Compound: Histone H2B.1,Histone H2A.Z
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02293 (1-95)
      • initiating methionine (0)
    • Uniprot Q12692 (96-End)
    Domains in SCOPe 2.07: d6ae8b1, d6ae8b2
  • Chain 'C':
    Compound: Histone H2A.Z-specific chaperone CHZ1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: CHZ1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Histone H2A.Z-specific chaperone CHZ1
    Species: Saccharomyces cerevisiae S288c [TaxId:559292]
    Gene: CHZ1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: BCN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ae8A (A:)
    mrketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisa
    reiqtavrlilpgelakhavsegtravtkyssstqaqsssaraglqfpvgrikrylkrha
    tgrtrvgskaaiyltavleyltaevlelagnaakdlkvkritprhlqlairgddeldsli
    ratiasggvlphi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ae8A (A:)
    rketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisar
    eiqtavrlilpgelakhavsegtravtkyssstqaqsssaraglqfpvgrikrylkrhat
    grtrvgskaaiyltavleyltaevlelagnaakdlkvkritprhlqlairgddeldslir
    at
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ae8B (B:)
    mrketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisa
    reiqtavrlilpgelakhavsegtravtkyssstqaqsssaraglqfpvgrikrylkrha
    tgrtrvgskaaiyltavleyltaevlelagnaakdlkvkritprhlqlairgddeldsli
    ratiasggvlphi
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ae8B (B:)
    mrketyssyiykvlkqthpdtgisqksmsilnsfvndiferiateasklaaynkkstisa
    reiqtavrlilpgelakhavsegtravtkyssstqaqsssaraglqfpvgrikrylkrha
    tgrtrvgskaaiyltavleyltaevlelagnaakdlkvkritprhlqlairgddeldsli
    ra
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.