PDB entry 6adw

View 6adw on RCSB PDB site
Description: Crystal structure of the Zika virus NS3 helicase (apo form)
Class: hydrolase
Keywords: Zika virus NS3 helicase, apo form, HYDROLASE
Deposited on 2018-08-02, released 2019-03-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-13, with a file datestamp of 2019-03-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease NS3
    Species: Zika virus (strain Mr 766) [TaxId:64320]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6adwa1, d6adwa2
  • Heterogens: SO4, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6adwA (A:)
    mhhhhhhsssgpsmlkkkqltvldlhpgagktrrvlpeivreaikkrlrtvilaptrvva
    aemeealrglpvrymttavnvthsgteivdlmchatftsrllqpirvpnynlnimdeahf
    tdpssiaargyistrvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgf
    dwvtdhsgktvwfvpsvrngneiaacltkagkrviqlsrktfetefqktknqewdfvitt
    disemganfkadrvidsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgd
    eymygggcaetdeghahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqr
    ktfvelmkrgdlpvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtkygekrv
    lkprwmdarvcsdhaalksfkefaagkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adwA (A:)
    mlkkkqltvldlhpgagktrrvlpeivreaikkrlrtvilaptrvvaaemeealrglpvr
    ymttavnvhsgteivdlmchatftsrllqpirvpnynlnimdeahftdpssiaargyist
    rvemgeaaaifmtatppgtrdafpdsnspimdtevevperawssgfdwvtdhsgktvwfv
    psvrngneiaacltkagkrviqlsrktfetefqktknqewdfvittdisemganfkadrv
    idsrrclkpvildgervilagpmpvthasaaqrrgrigrnpnkpgdeymygggcaetdeg
    hahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdlpv
    wlayqvasagitytdrrwcfdgttnntimedsvpaevwtkygekrvlkprwmdarvcsdh
    aalksfkefaagkr