PDB entry 6adb

View 6adb on RCSB PDB site
Description: Crystal structure of the E148N mutant CLC-ec1 in 20mM bromide
Class: transport protein
Keywords: CLC Cl-/H+ antiporter, intermediate structure, external glutamate, TRANSPORT PROTEIN
Deposited on 2018-07-31, released 2019-08-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-08-28, with a file datestamp of 2019-08-23.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: clcA, eriC, yadQ, b0155, JW5012
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered mutation (147)
    Domains in SCOPe 2.07: d6adba_
  • Chain 'B':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: clcA, eriC, yadQ, b0155, JW5012
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered mutation (147)
    Domains in SCOPe 2.07: d6adbb_
  • Chain 'C':
    Compound: antibody fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ADB (0-221)
    Domains in SCOPe 2.07: d6adbc1, d6adbc2
  • Chain 'D':
    Compound: antibody fab fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ADB (0-210)
    Domains in SCOPe 2.07: d6adbd1, d6adbd2
  • Chain 'E':
    Compound: antibody fab fragment, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ADB (Start-221)
    Domains in SCOPe 2.07: d6adbe1, d6adbe2
  • Chain 'F':
    Compound: antibody fab fragment, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6ADB (0-210)
    Domains in SCOPe 2.07: d6adbf1, d6adbf2
  • Heterogens: BR

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6adbA (A:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgrngptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarskaasasent
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adbA (A:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgrngptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqeaeq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6adbB (B:)
    mktdtpsletpqaarlrrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawl
    qnqrmgalvhtadnypllltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqr
    pvrwwrvlpvkffgglgtlgggmvlgrngptvqiggnigrmvldifrlkgdearhtllat
    gaaaglaaafnaplagilfiieemrpqfrytlisikavfigvimstimyrifnhevalid
    vgklsdaplntlwlylilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigg
    lcgllgfvapatsgggfnlipiatagnfsmgmlvfifvarvittllcfssgapggifapm
    lalgtvlgtafgmvavelfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyq
    lilpmiitglgatllaqftggkplysailartlakqeaeqlarskaasasent
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adbB (B:)
    rrrqlirqllerdktplailfmaavvgtlvglaavafdkgvawlqnqrmgalvhtadnyp
    llltvaflcsavlamfgyflvrkyapeaggsgipeiegaledqrpvrwwrvlpvkffggl
    gtlgggmvlgrngptvqiggnigrmvldifrlkgdearhtllatgaaaglaaafnaplag
    ilfiieemrpqfrytlisikavfigvimstimyrifnhevalidvgklsdaplntlwlyl
    ilgiifgifgpifnkwvlgmqdllhrvhggnitkwvlmggaigglcgllgfvapatsggg
    fnlipiatagnfsmgmlvfifvarvittllcfssgapggifapmlalgtvlgtafgmvav
    elfpqyhleagtfaiagmgallaasirapltgiilvlemtdnyqlilpmiitglgatlla
    qftggkplysailartlakqea
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6adbC (C:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6adbD (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >6adbE (E:)
    evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
    tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
    sakttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqa
    alytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

    Sequence, based on observed residues (ATOM records): (download)
    >6adbE (E:)
    vrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstinyt
    pslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvss
    akttppsvyplapgsaaaaasmvtlgclvkgyfpepvtvtwnsgslaagvhtfpavlqaa
    lytlsssvtvpssswpsetvtcnvahpasstkvdkkivpra
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6adbF (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra