PDB entry 6acs

View 6acs on RCSB PDB site
Description: poly-cis-prenyltransferase
Class: transferase
Keywords: citrate, complex, undecaprenyl pyrophosphate, synthase, UPPS, TRANSFERASE
Deposited on 2018-07-27, released 2018-12-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-19, with a file datestamp of 2018-12-14.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: uppS, ispU, ABUW_1737, AM462_03305, CBI29_02230
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acsa_
  • Chain 'B':
    Compound: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
    Species: ACINETOBACTER BAUMANNII [TaxId:470]
    Gene: uppS, ispU, ABUW_1737, AM462_03305, CBI29_02230
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0D5YHU7 (Start-249)
      • expression tag (250-252)
    Domains in SCOPe 2.07: d6acsb1, d6acsb2
  • Heterogens: CIT, IPA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6acsA (A:)
    mtdseeyhlpqhvaiimdgnnrfakknqmqkgdghregknvldpivehcvktgvraltvf
    afssenwnrpqyevdllmklleetiheqiprmkkfnialrfigdrsrlpshlvalmedae
    qqtahheamtltiavsyggmwdianaakqvaqavsrgeidadqinvdlfakyvslndlpa
    vdllirtggdfrisnfllwqaayaelyftdtlwpeftveefdhalnvfsgrerrfgktse
    qiqqekiekllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6acsA (A:)
    dseeyhlpqhvaiimdgnnrfakknvldpivehcvktgvraltvfafssenwnrpqyevd
    llmklleetiheqiprmkkfnialrfigdrsrlpshlvalmedaeqqtahheamtltiav
    syggmwdianaakqvaqavsrgeidadqinvdlfakyvslndlpavdllirtggdfrisn
    fllwqaayaelyftdtlwpeftveefdhalnvfsgrerrfgktse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6acsB (B:)
    mtdseeyhlpqhvaiimdgnnrfakknqmqkgdghregknvldpivehcvktgvraltvf
    afssenwnrpqyevdllmklleetiheqiprmkkfnialrfigdrsrlpshlvalmedae
    qqtahheamtltiavsyggmwdianaakqvaqavsrgeidadqinvdlfakyvslndlpa
    vdllirtggdfrisnfllwqaayaelyftdtlwpeftveefdhalnvfsgrerrfgktse
    qiqqekiekllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6acsB (B:)
    eyhlpqhvaiimdgnknvldpivehcvktgvraltvfafsnrpqyevdllmklleetihe
    qiprmkkfnialrfigdrsrlpshlvalmedaeqqtahheamtltiavsyggmwdianaa
    kqvaqavsrgeidadqinvdlfakyvslndlpavdllirtggdfrisnfllwqaayaely
    ftdtlwpeftveefdhalnvfsgrerrfgktseqiqqekieklleh