PDB entry 6acr

View 6acr on RCSB PDB site
Description: Crystal structure of human ALK2 kinase domain with R206H mutation in complex with RK-59638
Class: signaling protein
Keywords: Inhibitor, Complex, Kinase, SIGNALING PROTEIN
Deposited on 2018-07-27, released 2019-03-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-03-20, with a file datestamp of 2019-03-15.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVR1, ACVRLK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04771
      • engineered mutation (7)
    Domains in SCOPe 2.07: d6acra_
  • Chain 'B':
    Compound: Activin receptor type-1
    Species: Homo sapiens [TaxId:9606]
    Gene: ACVR1, ACVRLK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04771
      • engineered mutation (7)
    Domains in SCOPe 2.07: d6acrb_
  • Heterogens: 9TO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6acrA (A:)
    smqrtvahqitllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlr
    henilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglah
    lhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgt
    krymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpnd
    psfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6acrA (A:)
    tvahqitllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrheni
    lgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhie
    ifggkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkrymap
    evldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsfedm
    rkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6acrB (B:)
    smqrtvahqitllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlr
    henilgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglah
    lhieifgtqgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgt
    krymapevldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpnd
    psfedmrkvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >6acrB (B:)
    tvahqitllecvgkgrygevwrgswqgenvavkifssrdekswfretelyntvmlrheni
    lgfiasdmtsrhsstqlwlithyhemgslydylqlttldtvsclrivlsiasglahlhie
    ifgkpaiahrdlksknilvkkngqcciadlglavmhsqstnqldvgnnprvgtkrymape
    vldetiqvdcfdsykrvdiwafglvlwevarrmvsngivedykppfydvvpndpsfedmr
    kvvcvdqqrpnipnrwfsdptltslaklmkecwyqnpsarltalrikktltki