PDB entry 6acn

View 6acn on RCSB PDB site
Description: structure of activated aconitase. formation of the (4fe-4s) cluster in the crystal
Deposited on 1990-01-16, released 1990-07-15
The last revision prior to the SCOP 1.57 freeze date was dated 1990-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.187
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6acn_ (-)
    erakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkt
    ylrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdin
    qevynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicig
    vggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaivey
    hgpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlv
    pdpgchydqvieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctn
    ssyedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlana
    cgpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkf
    npetdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlql
    lepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainienr
    kansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehsaleprhlggraii
    tksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkplkciikhpng
    tqetillnhtfnetqiewfragsalnrmkelqqk