PDB entry 6aci

View 6aci on RCSB PDB site
Description: Crystal structure of EPEC effector NleB in complex with FADD death domain
Class: toxin
Keywords: toxin, glycosyltransferase
Deposited on 2018-07-26, released 2019-05-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-05-01, with a file datestamp of 2019-04-26.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T3SS secreted effector NleB homolog
    Species: Escherichia coli O127:H6 [TaxId:574521]
    Gene: E2348C_3231
    Database cross-references and differences (RAF-indexed):
    • Uniprot B7UI21 (4-305)
      • expression tag (2-3)
      • engineered mutation (91)
  • Chain 'H':
    Compound: FAS-associated death domain protein
    Species: Homo sapiens [TaxId:9606]
    Gene: FADD, MORT1, GIG3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6acih_
  • Heterogens: UDP, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6aciH (H:)
    geedlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknte
    kenatvahlvgalrscqmnlvadlvqevqqar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aciH (H:)
    dlcaafnvicdnvgkdwrrlarqlkvsdtkidsiedryprnltervreslriwknteken
    atvahlvgalrscqmnlvadlvqevqq