PDB entry 6ac9

View 6ac9 on RCSB PDB site
Description: Crystal structure of human Vaccinia-related kinase 1 (VRK1) in complex with AMP-PNP
Class: transferase
Keywords: Kinase, Vaccinia-related kinase, VRK1, Adenosine triphosphate, ATP, AMP-PNP, TRANSFERASE
Deposited on 2018-07-25, released 2018-12-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-26, with a file datestamp of 2018-12-21.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (291-292)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d6ac9a_
  • Chain 'B':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (291-292)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d6ac9b_
  • Chain 'C':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (291-292)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d6ac9c_
  • Chain 'D':
    Compound: Serine/threonine-protein kinase VRK1
    Species: Homo sapiens [TaxId:9606]
    Gene: VRK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99986
      • engineered mutation (33-35)
      • engineered mutation (211)
      • engineered mutation (213-214)
      • engineered mutation (291-292)
      • engineered mutation (294)
    Domains in SCOPe 2.07: d6ac9d_
  • Heterogens: ANP, MG, SO4, CL, PG4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ac9A (A:)
    mprvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eieehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ac9A (A:)
    eqfavgeiitdmaaaawkvglpigciyladmnssesvgsdapcvvkvepsdngplftelk
    fyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyean
    akrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayryc
    pegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednl
    kdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdill
    qglkaigskddgkldls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6ac9B (B:)
    mprvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eieehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ac9B (B:)
    eqfavgeiitdmaaaawkvglpigciyladmnssesvgsdapcvvkvepsdngplftelk
    fyqraakpeqiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyean
    akrfsrktvlqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayryc
    pegvhkayaadpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednl
    kdpkyvrdskiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdill
    qglkaigskddgkldl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >6ac9C (C:)
    mprvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eieehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ac9C (C:)
    avgeiitdmaaaawkvglpgciyladmngsdapcvvkvepsdngplftelkfyqraakpe
    qiqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyeanakrfsrktv
    lqlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayrycpegvhkaya
    adpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednlkdpkyvrds
    kiryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdillqglkaigsk
    ddgkldl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6ac9D (D:)
    mprvkaaqagrqssakrhlaeqfavgeiitdmaaaawkvglpigqggfgciyladmnsse
    svgsdapcvvkvepsdngplftelkfyqraakpeqiqkwirtrklkylgvpkywgsglhd
    kngksyrfmimdrfgsdlqkiyeanakrfsrktvlqlslrildileyiheheyvhgdika
    snlllnyknpdqvylvdyglayrycpegvhkayaadpkrchdgtieftsidahngvapsr
    rgdleilgycmiqwltghlpwednlkdpkyvrdskiryreniaslmdkcfpaanapgeia
    kymetvklldytekplyenlrdillqglkaigskddgkldlsvvengglkaktitkkraa
    eieehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ac9D (D:)
    favgeiitdmaaaawkvglpiciyladmsdapcvvkvepsdngplftelkfyqraakpeq
    iqkwirtrklkylgvpkywgsglhdkngksyrfmimdrfgsdlqkiyeanakrfsrktvl
    qlslrildileyiheheyvhgdikasnlllnyknpdqvylvdyglayrycpegvhkayaa
    dpkrchdgtieftsidahngvapsrrgdleilgycmiqwltghlpwednlkdpkyvrdsk
    iryreniaslmdkcfpaanapgeiakymetvklldytekplyenlrdillqglkaigskd
    dgkldl