PDB entry 6abw

View 6abw on RCSB PDB site
Description: Crystal structure of citrate synthase (Msed_0281) from Metallosphaera sedula in complex with acetyl-CoA
Class: transferase
Keywords: Citrate synthase, Metallosphaera sedula, TRANSFERASE
Deposited on 2018-07-24, released 2019-01-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 1.7200000000000002 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: citrate synthase
    Species: Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) [TaxId:399549]
    Gene: Msed_0281
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d6abwa_
  • Heterogens: GOL, ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6abwA (A:)
    mrgshhhhhhgsmsqisrglenvfikttsltyidgengilryggydiedlvehtsfeevv
    hlmlygdlptklqlqrlksaldeayevpqqvidmiyslprdsdavgmmetafsalssiyg
    mpwnkatnrdnavklvarastvvanvlrakegkkpaipepsesfaksflkasfsrtptee
    evkamdaalilyadhevpasttaalvtsstlsdiyscvvaalaalkgplhggaaeeafkq
    fveigepdmteswfkrkiiegksrlmgfghrvyktydprakifkkyakvisernsdarky
    feiaqkleelgvetfgakhiypntdfysgvvfyalgfpvymftslfalsrtlgwtahvie
    yvedqhrlirpralyvgplkrdvvpielrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6abwA (A:)
    envfikttsltyidgengilryggydiedlvehtsfeevvhlmlygdlptklqlqrlksa
    ldeayevpqqvidmiyslprdsdavgmmetafsalssiygmpwnkatnrdnavklvaras
    tvvanvlrakegkkpaipepsesfaksflkasfsrtpteeevkamdaalilyadhevpas
    ttaalvtsstlsdiyscvvaalaalkgplhggaaeeafkqfveigepdmteswfkrkiie
    gksrlmgfghrvyktydprakifkkyakvisernsdarkyfeiaqkleelgvetfgakhi
    ypntdfysgvvfyalgfpvymftslfalsrtlgwtahvieyvedqhrlirpralyvgplk
    rdvvpielr