PDB entry 6abt

View 6abt on RCSB PDB site
Description: Crystal structure of transcription factor from Listeria monocytogenes
Class: DNA binding protein
Keywords: Bacteria, PadR, transcription factor, DNA BINDING PROTEIN
Deposited on 2018-07-23, released 2019-06-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-06-05, with a file datestamp of 2019-05-30.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PadR family transcriptional regulator
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: C7K50_07245, CDR86_13565, LmNIHS28_00834
    Database cross-references and differences (RAF-indexed):
    • Uniprot L8DXR9 (1-97)
      • expression tag (0)
    Domains in SCOPe 2.07: d6abta1, d6abta2
  • Chain 'B':
    Compound: PadR family transcriptional regulator
    Species: Listeria monocytogenes [TaxId:1639]
    Gene: C7K50_07245, CDR86_13565, LmNIHS28_00834
    Database cross-references and differences (RAF-indexed):
    • Uniprot L8DXR9 (1-97)
      • expression tag (0)
    Domains in SCOPe 2.07: d6abtb1, d6abtb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6abtA (A:)
    alkgslegmilerisrgetygyeitkylndlgfdeivegtvytilvrlekkglveiekkk
    selgpprkfytlspageeelaifwkrwdfiqgkimqvk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6abtB (B:)
    alkgslegmilerisrgetygyeitkylndlgfdeivegtvytilvrlekkglveiekkk
    selgpprkfytlspageeelaifwkrwdfiqgkimqvk