PDB entry 6abo

View 6abo on RCSB PDB site
Description: human XRCC4 and IFFO1 complex
Class: nuclear protein
Keywords: complex, coiled-coil, NUCLEAR PROTEIN
Deposited on 2018-07-23, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair protein xrcc4
    Species: Homo sapiens [TaxId:9606]
    Gene: XRCC4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aboa1, d6aboa2
  • Chain 'B':
    Compound: Intermediate filament family orphan 1
    Species: Homo sapiens [TaxId:9606]
    Gene: IFFO1, IFFO
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0D2I5 (5-End)
      • expression tag (1-4)
    Domains in SCOPe 2.07: d6abob1, d6abob2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aboA (A:)
    mgsshhhhhhsqgsmerkisrihlvsepsithflqvswektlesgfvitltdghsawtgt
    vseseisqeaddmamekgkyvgelrkallsgagpadvytfnfskescyfffeknlkdvsf
    rlgsfnlekvenpaevirelicycldtiaenqaknehlqkenerllrdwndvqgrfekcv
    sakealetdlykrfilvlnekktkirslhnkllnaaqerekdikqeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aboA (A:)
    merkisrihlvsepsithflqvswektlesgfvitltdghsawtgtvseseisqeaddma
    mekgkyvgelrkallsgagpadvytfnfskescyfffeknlkdvsfrlgsfnlekvenpa
    evirelicycldtiaenqaknehlqkenerllrdwndvqgrfekcvsakealetdlykrf
    ilvlnekktkirslhnkllnaaqerekdikqeg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >6aboB (B:)
    marsmeqqedslekvikdteslfktrekeyqetidqielelatakndmnrhlheymemcs
    mkrgldvqmetcrrlitqsgdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aboB (B:)
    arsmeqqedslekvikdteslfktrekeyqetidqielelatakndmnrhlheymemcsm
    krgldvqmetcrrlitq