PDB entry 6ab9

View 6ab9 on RCSB PDB site
Description: The crystal structure of the relaxed state of Nonlabens marinus Rhodopsin 3
Class: membrane protein
Keywords: Rhodopsin, Nonlabens marinus, Chloride importer, Photoactivation, All-trans retinal, MEMBRANE PROTEIN
Deposited on 2018-07-20, released 2019-07-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-31, with a file datestamp of 2019-07-26.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chloride pumping rhodopsin
    Species: Nonlabens marinus S1-08 [TaxId:1454201]
    Gene: ClR, NMS_1267
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6ab9a_
  • Heterogens: CL, RET, OLA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6ab9A (A:)
    masmtggqqmgrdpnsmknieslfdysagqfefidhlltmgvgvhfaalifflvvsqfva
    pkyriatalscivmvsaglilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatip
    clllqllivlnlkgkelfstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaff
    vvmnwivgtkifknratmlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrq
    llftiadisskviyglmityiaiqqsaaagyvpaqqalgrigmdskaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6ab9A (A:)
    knieslfdysagqfefidhlltmgvgvhfaalifflvvsqfvapkyriatalscivmvsa
    glilnsqavmwtdayayvdgsyqlqdltfsngyryvnwmatipclllqllivlnlkgkel
    fstatwlilaawgmiitgyvgqlyevddiaqlmiwgavstaffvvmnwivgtkifknrat
    mlggtdstitkvfwlmmfawtlypiaylvpafmnnadgvvlrqllftiadisskviyglm
    ityiaiqqsaaagyvpaqqalgri