PDB entry 6aar

View 6aar on RCSB PDB site
Description: Crystal structure of DAPK1 in complex with purpurin
Class: transferase
Keywords: death-associated protein kinase 1, serin/threonine protein kinase, hydrolase, transferase
Deposited on 2018-07-19, released 2019-07-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK1, DAPK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6aara_
  • Heterogens: 9TF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6aarA (A:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalslehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >6aarA (A:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdlteeeateflkqilngvy
    ylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtpefvapei
    vnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyfsntsala
    kdfirrllvkdpkkrmtiqdslqhpwikp